PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01180.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 292aa    MW: 30652.8 Da    PI: 7.0516
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01180.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.54.8e-3865140280
                           TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                                   a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++ +as+    +s+ 
  Zmw_sc01180.1.g00070.1.sm.mk  65 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTMPASAL---ASVP 140
                                   789*************************************************************99999655...3333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.5E-3270251IPR005333Transcription factor, TCP
PROSITE profilePS5136928.03971125IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDPKFPTHPP LNKTEPTAST TTTTTSTPQQ QQTDPKDYHH HHHHHQQLQV VGPPAAGERR  60
QQSLAPKRSS NKDRHTKVDG RGRRIRMPAL CAARIFQLTR ELGHKSDGET VQWLLQQAEP  120
AIVAATGTGT MPASALASVP SLPSPNAALA RPHHHHVWAP LAASAGFSSA GFLNSAAGGA  180
ADAAGIGGFM QRMGIPAGLE LPGAGAAGGH IGFAPMFAGH AAAGVPGLEL GLSQDGHIGV  240
LAPQSFSQFY HHVGAAGGSG QLQHPHQHNQ HQQQEDGEDE REDANSDEES GQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456872.11e-120hypothetical protein SORBIDRAFT_03g044320
SwissprotQ9LSD54e-54TCP20_ARATH; Transcription factor TCP20
TrEMBLC5XGD61e-120C5XGD6_SORBI; Putative uncharacterized protein Sb03g044320
STRINGSb03g044320.11e-120(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269